SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014296 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014296
Domain Number 1 Region: 7-243
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.46e-73
Family Tyrosine-dependent oxidoreductases 0.00000000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014296   Gene: ENSMMUG00000010896   Transcript: ENSMMUT00000015254
Sequence length 244
Comment pep:known_by_projection chromosome:MMUL_1:16:77474405:77476220:-1 gene:ENSMMUG00000010896 transcript:ENSMMUT00000015254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWGLAGRRVLVTGAGKGIGRGTVQALHAAGARVVAVSRTQADLDSLVRECPGIEPVCVD
LGDWEATERALGSVGPVDLLVNNAAVALLQPFLEVTKDAFDRSFEVNLRAVIQVSQIVAR
GLIARGAPGAIVNISSQCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPT
VVMTHMGQATWSDPCKAKTMLDRIPLGKFAEVEHVVDAILFLLSDRSGMTTGSTLPVEGG
FWAN
Download sequence
Identical sequences ENSMMUP00000014296 ENSMMUP00000014296 9544.ENSMMUP00000014296 XP_001112983.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]