SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014304 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014304
Domain Number 1 Region: 169-363
Classification Level Classification E-value
Superfamily E set domains 1.17e-79
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000852
Further Details:      
 
Domain Number 2 Region: 63-185
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.34e-24
Family Voltage-gated potassium channels 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014304   Gene: ENSMMUG00000010903   Transcript: ENSMMUT00000015262
Sequence length 433
Comment pep:known chromosome:MMUL_1:16:20547093:20587556:1 gene:ENSMMUG00000010903 transcript:ENSMMUT00000015262 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAASRANPYSIVSSEEDGLHLVTMSGANGFGNGKVHTRRRCRNRFVKKNGQCNIEFANM
DEKSQRYLADMFTTCVDIRWRYMLLIFSLAFLASWLLFGVIFWVIAVVHGDLEPAEGRGR
TPCVMQVHGFMAAFLFSIETQTTIGYGLRCVTEECPVAVFMVVAQSIVGCIIDSFMIGAI
MAKMARPKKRAQTLLFSHNAVVALRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRVTEE
GEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIDEASPLFGISRQDLETDDFEIVVILE
GMVEATAMTTQARSSYLANEILWGHRFEPVLFEEKNQYKIDYSHFHKTYEVPSTPRCSAK
DLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGSG
ALEQRPYRRESEI
Download sequence
Identical sequences A0A0D9S9A5 A0A2K5KTW1 F7GLZ2 G7PTV6
9544.ENSMMUP00000014304 ENSMMUP00000014304 ENSPANP00000009116 XP_001104273.1.72884 XP_005583207.1.63531 XP_008008878.1.81039 XP_008008879.1.81039 XP_011759163.1.29376 XP_011932645.1.92194 XP_011932646.1.92194 XP_015293269.1.63531 ENSMMUP00000014304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]