SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014327 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014327
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.45e-39
Family Spermadhesin, CUB domain 0.00033
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 6.55e-38
Family Link domain 0.00000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014327   Gene: ENSMMUG00000010927   Transcript: ENSMMUT00000015287
Sequence length 277
Comment pep:known chromosome:MMUL_1:12:14986913:15008539:1 gene:ENSMMUG00000010927 transcript:ENSMMUT00000015287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIILIYLFLLLWEEAQGWGFKDGIFHNSIWLERAAGVYHRESRSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDSKGIFKSPGFPNEYEDNQICYWHIRLKYGQHIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPVSKSSQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences A0A2K6AQ64 F7GLN3 G7PKK5
NP_001252869.1.72884 XP_005573240.1.63531 XP_011758208.1.29376 ENSMMUP00000014327 9544.ENSMMUP00000014327 ENSMMUP00000014327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]