SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014402 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014402
Domain Number 1 Region: 18-117
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 5.76e-25
Family 4'-Phosphopantetheinyl transferase SFP 0.0069
Further Details:      
 
Domain Number 2 Region: 125-250
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.96e-23
Family 4'-Phosphopantetheinyl transferase SFP 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014402   Gene: ENSMMUG00000010990   Transcript: ENSMMUT00000015371
Sequence length 309
Comment pep:known chromosome:MMUL_1:14:104681126:104701278:1 gene:ENSMMUG00000010990 transcript:ENSMMUT00000015371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAA
MAGRLMIRKLVAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAA
EPELQVGIDIMKTSFPGRGSIPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALK
ESFIKAIGVGLGFELQRLEFDLSPLNLDIGQVYKETRLFLDGEEEKEWAFEESKIDEHHF
VAVALRKPDGSRHQDVPSQDNSKPTQRQFTILNFNDLISSAVPMTPEDPSFWDCFCFTEE
IPIRNGTKS
Download sequence
Identical sequences A0A2K5WSI6 F7GS66
9544.ENSMMUP00000014402 ENSMMUP00000014402 ENSMMUP00000014402 NP_001164660.1.72884 XP_005579567.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]