SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014432 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014432
Domain Number 1 Region: 9-99
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 9.13e-24
Family Canonical RBD 0.0021
Further Details:      
 
Domain Number 2 Region: 91-126
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000209
Family Retrovirus zinc finger-like domains 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014432   Gene: ENSMMUG00000011025   Transcript: ENSMMUT00000015408
Sequence length 238
Comment pep:known chromosome:MMUL_1:13:38731174:38738172:-1 gene:ENSMMUG00000011025 transcript:ENSMMUT00000015408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDA
EDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
RYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSR
SGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
Download sequence
Identical sequences A0A096NRM9 A0A2K5JZB0 A0A2K5LRC9 A0A2K5ZNA6 A0A2K6CRY8 A0A2K6NAK4 A0A2K6TB12 F7FB03 G1S2V5 G3RFA0 H2P6G3 H2QHS3 I0FU68 Q16629 Q4R4Z7
ENSP00000325905 ENSNLEP00000019843 ENSP00000325905 ENSMMUP00000014432 9544.ENSMMUP00000014432 9598.ENSPTRP00000020349 9600.ENSPPYP00000013939 9606.ENSP00000325905 ENSCJAP00000048214 OPTIC1560 NP_001026854.1.87134 NP_001026854.1.92137 NP_001182515.1.72884 NP_001182519.1.23681 NP_001270997.1.63531 XP_002757879.1.60252 XP_003262805.1.23891 XP_003926840.1.74449 XP_004029157.1.27298 XP_008969134.1.60992 XP_009440622.1.37143 XP_010362435.1.97406 XP_011791332.1.43180 XP_011852721.1.47321 XP_011940534.1.92194 gi|72534660|ref|NP_001026854.1| ENSMMUP00000014432 ENSPPYP00000013939 ENSCJAP00000028057 ENSP00000325905 ENSPTRP00000020349 ENSPTRP00000020349 ENSPPYP00000013939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]