SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014653 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014653
Domain Number 1 Region: 23-139
Classification Level Classification E-value
Superfamily Immunoglobulin 8.12e-29
Family V set domains (antibody variable domain-like) 0.00042
Further Details:      
 
Domain Number 2 Region: 139-261
Classification Level Classification E-value
Superfamily Immunoglobulin 3.68e-26
Family C1 set domains (antibody constant domain-like) 0.0000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014653   Gene: ENSMMUG00000011188   Transcript: ENSMMUT00000015644
Sequence length 315
Comment pep:novel chromosome:MMUL_1:3:179828284:180435982:1 gene:ENSMMUG00000011188 transcript:ENSMMUT00000015644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCRLLCCVALCLLQAGSLDTAVSQTPKYLVRQTGKNESLKCEQNLGHDAMYWYKQDSKK
LLKIMFIYNNKEPILNETVPYRFSPKSPDKAHLNLHIKSLELGDSAVYFCASSQDTALQN
SENESFFGQGTRLTVLEDLKKVFPPKVAVFEPSEAEISHTQKATLVCLATGFYPDHVELS
WWVNGKEVHSGVSTDPQPLKEQPALEDSRYCLSSRLRVSATFWHNPRNHFRCQVQFYGLS
EDDEWTEDRDKPITQKISAEVWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVS
ALMLMAMVSRRAGWG
Download sequence
Identical sequences ENSMMUP00000014653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]