SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014720 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014720
Domain Number 1 Region: 45-509
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.73e-109
Family L-arabinose binding protein-like 0.0000000556
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014720
Domain Number - Region: 519-579
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00628
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014720   Gene: ENSMMUG00000011231   Transcript: ENSMMUT00000015714
Sequence length 920
Comment pep:known chromosome:MMUL_1:2:53271288:54123531:-1 gene:ENSMMUG00000011231 transcript:ENSMMUT00000015714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGMPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYAS
TAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQI
SKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDINGKVCACLY
PDTYSSSMVWKTKDEDSKFSPSKHTDLSAGVRTSRDYMGTIVRFDAYFTSRTLENNRRNV
WFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAHAL
HHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGDAGTPVMFNKNGDAPGRYDIFQY
QTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPPSVCTLPCKPGQRKKTQKGTPCC
WTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAMLGI
IATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRVFL
GLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIWFG
VDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGVPE
NFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGMLYM
PKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNNCI
PPVRKSVQKSVTWYTIPPTV
Download sequence
Identical sequences ENSMMUP00000014720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]