SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014798 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014798
Domain Number 1 Region: 210-285
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000637
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014798
Domain Number - Region: 276-316
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0253
Family Leucine zipper domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014798   Gene: ENSMMUG00000011291   Transcript: ENSMMUT00000015794
Sequence length 329
Comment pep:known_by_projection chromosome:MMUL_1:19:41767372:41777635:1 gene:ENSMMUG00000011291 transcript:ENSMMUT00000015794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APGSHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFGDHNIQYQFRTETNGGQV
TYRVVQVTDGQLDGQGDTTGAVSVVSTAAFAGGQQAVTQVGVDGAAQRPGPAAASVPPGP
AAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQAGGQFY
VMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQHNEVERRRRDKINNWIVQ
LSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQ
IEELKNENALLRAQLQQHNLEMVGESTRQ
Download sequence
Identical sequences 9544.ENSMMUP00000014798 ENSMMUP00000014799 ENSMMUP00000014798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]