SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014864 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014864
Domain Number 1 Region: 131-217
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000677
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014864   Gene: ENSMMUG00000011330   Transcript: ENSMMUT00000015863
Sequence length 416
Comment pep:known chromosome:MMUL_1:19:53348260:53372444:1 gene:ENSMMUG00000011330 transcript:ENSMMUT00000015863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSSVFDYIHPGDHSEVLEQLGLRTPTPGPPTPPSVSSSSSSSSSSLADTPEIEASLTK
VPPSSLVQERSFFVRMKSTLTKRGLHVKASGYKQVIHVTGRLRAHALGLVALGHTLPPAP
LAELPLHGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRIRQSH
VDLLDKGQVMTGYYRWLRRAGGFVWLQSVATVAGSGKSPGEHHVLWVSHVLSQAEGGQTP
LDAFQLPASVACEEASSPGPEPTELEPPTEGKQAAPAENEVPQTQGKRIKVEPSPRETKG
SEDSGDEDPSGHPATPRPEFTSVIRAGVLKQDPVRPWGLAPPGDPPPALLHAGFLPPVVR
GLCTPGTIRYGPAELGLVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD
Download sequence
Identical sequences ENSMMUP00000014864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]