SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014900 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014900
Domain Number 1 Region: 291-383
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-17
Family I set domains 0.042
Further Details:      
 
Domain Number 2 Region: 143-196
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 213-287
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000222
Family Carboxypeptidase regulatory domain 0.056
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014900
Domain Number - Region: 473-526
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000706
Family Carboxypeptidase regulatory domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014900   Gene: ENSMMUG00000011352   Transcript: ENSMMUT00000015899
Sequence length 1156
Comment pep:known_by_projection scaffold:MMUL_1:1099214741702:18005:25611:-1 gene:ENSMMUG00000011352 transcript:ENSMMUT00000015899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLLPLLCLCVVAAHLAGARDTNPTEEPRATALGLERRSVYPGQPSPALEDWEEASEWT
SWFNVDHPGGDGDFESLAAIRFYYGPARVCPRPLALEARTTDWALPSTVGERVHLNPTRG
FWCLNREQPRGRRCSNYHVRFRCPLEASWGAWGPWGPCSGSCGPSRRLRRRHCPSPAGDA
CPGRPLEAQRCVRPRCPGCGLDTCECPDHILLGSVVTRSGQPLPGARISLRDQPGTVATS
DAHGTFRVLGVCADSHANIRAQMDGFSAGEAQAQANGSISVVTIILDKLERPYLVKHPES
RVREAGQNVTFCCKASGTPMPKKYSWFHNGTLLDRRAHRYGAHLELQGLHPDQAGIYHCK
AWNEAGAVRSGTAWLTVLAPGQPSCDPQPQEYLIKLPEDCGQPGSGPAYLDVGLCPNTHC
PSLAGSGPRCGDTSSRCCSVRRLERREIHCPGYVLPVKVVAECGCQKCLPPRGLVRGRVV
AADSGEPLRFARILLGQEPIGFTAYQGDFTIEVPPSTQRLVVTFVDPSGEFMDAVRVLPF
DPRGAGVYHEVKAMRKKAPVILDASQSNTIPLGELEDEAPLGELVLPSGAFHRADGKPYS
GPVEARVTFVDPRDLTSAASAPSDLRFMDSDGELALLRTYGMFSVDLRAPGSAEQLQVGP
VTVRVAASQMHMPGHVEALKLWSLNPETGLWEEESSFRREGSSGTRVRREERIFLVGNVE
IRERRLFNLDVPERRRCFVKVRAYANDKFNPSEQVEGVVVTLVNLEPAPGFSANPRAWGR
FDSAVTGPNGACLPAFCDADRPDAYTALVTATLGGEELEPAPSLPRPLPATVGVTQPYLD
RLGYRRTDHDDPAFKRNGFRINLAKPRPGDPTEANGPVYPWRSLRECQGAPVTASHFRFA
RVEADKYEYNVVPFREGTPASWTGDLLAWWPNPQEFRACFLKVKIQGPQEYMVRSHNSGG
SHPRTRGQLYGLRDARSVRDPERPGTSAACVEFKCGGMLFDQRQVDRTLVTIMPQGSCRR
VAVNGLLRDYLARHPPPVPAEDPAAFSMLAPLDPLGHNYGVYTVTDQSPRLAKEIAIGRC
FDGSSDGFSREMKADAGTAVTFQCREPPAGRPSLFQRLLESPATALGDIRREMSEVAQAR
ARASGPLRTRRGRVRQ
Download sequence
Identical sequences XP_001100671.1.72884 ENSMMUP00000014900 ENSMMUP00000014900 9544.ENSMMUP00000014900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]