SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015035 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015035
Domain Number 1 Region: 32-127
Classification Level Classification E-value
Superfamily Immunoglobulin 7.44e-25
Family V set domains (antibody variable domain-like) 0.00044
Further Details:      
 
Domain Number 2 Region: 142-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000187
Family I set domains 0.0049
Further Details:      
 
Domain Number 3 Region: 323-412
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000957
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 242-302
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000266
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015035   Gene: ENSMMUG00000001696   Transcript: ENSMMUT00000016042
Sequence length 412
Comment pep:novel scaffold:MMUL_1:1099548049382:251400:263029:1 gene:ENSMMUG00000001696 transcript:ENSMMUT00000016042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAPPCTLHITWKELLLTASLLIFWNPPTTAQVTIEAQPTKVSEGKDVLLLVHNLPQNVA
GYSWYKGQIMDLHHYITSYVIDTEIIIFGPAYSGRETVYSNASLLIQNVTQKDTGSYTIQ
ITKRGDGTKRVTGHFTLYLETPKPSINSSNLNPREGTETVILSCDPDTQDVSYLWWINGQ
SLPVSRKLQLSENNRTLVLSGVTKDTAGPYECEMKNPVSSSRSDPVTLNLLYILDASTMS
SSYTYYHTGEVPKISCLTDSHPLAEHSWLIDGKFQKSAQVFFIPEITKIYRGVYICFIHS
SATGGTNLVIKRVIVPVIHTAELPEPYITNNNFNPMENKNVVALTCEPKTQGYTYVWRVN
GQSLLVSPRLKQPGKNRILILTIVTRNDTGPYECEIRDRVGSICSDPVTLDV
Download sequence
Identical sequences ENSMMUP00000015035 ENSMMUP00000015035 9544.ENSMMUP00000015035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]