SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015113 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015113
Domain Number 1 Region: 2005-2149
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-43
Family C-type lectin domain 0.000000329
Further Details:      
 
Domain Number 2 Region: 477-583
Classification Level Classification E-value
Superfamily C-type lectin-like 6.07e-42
Family Link domain 0.0014
Further Details:      
 
Domain Number 3 Region: 150-260
Classification Level Classification E-value
Superfamily C-type lectin-like 6.91e-40
Family Link domain 0.0015
Further Details:      
 
Domain Number 4 Region: 588-702
Classification Level Classification E-value
Superfamily C-type lectin-like 1.69e-30
Family Link domain 0.0045
Further Details:      
 
Domain Number 5 Region: 262-355
Classification Level Classification E-value
Superfamily C-type lectin-like 5.54e-28
Family Link domain 0.0024
Further Details:      
 
Domain Number 6 Region: 33-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000598
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 7 Region: 2150-2210
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000667
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015113   Gene: ENSMMUG00000000554   Transcript: ENSMMUT00000016126
Sequence length 2235
Comment pep:known_by_projection chromosome:MMUL_1:7:68446462:68485132:1 gene:ENSMMUG00000000554 transcript:ENSMMUT00000016126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLWVFVTLRVIAAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEI
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFDVSPSPLEPEEPFTF
APEIGATAFPEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF
HYRPGSTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS
PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCYVDRLEGEVFFATRLEQFTFQEALEFCES
HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQT
GLPDPLSRHHAFCFRGVSAVPSPGEEEGGTPTSPSGVEDWIATQVVPGVAAVPVEEETTA
VPLGETTAILEFTTEPENQTEWEPAYTPMGTSPLPGILPTWPPTGTATEESTEGPSATEV
LTASKEPSPPEVPFPSEEPSPSEEPFPSVRPFPSVEPSPSEEPFPSVEPSPSEEPSASEE
PYTPSPPVPSWTELPGSGEESGAPDVSGDFIGSGDVSGHLDFSGQLSGDRISGLPSGDLD
SSGLTSTVGSGLPVDSGLASGDEERIEWSSTPTVGELPSGAEILEGSASEVGDLSGLPSG
DVLETSASGVGDLSGLPSGEVLETSVSGVGDLSGLPSGEVLETSTSGVGDLSGLPSGEVL
ETSTSGVGDLSGLPSAGEVLETTASGVEDISGLPSGEVLETTASGVEDISGFPSGEVLET
TASGVEDISGLPSGEVLETTASGVEDISGLPSGEVLETTASGVGDLGGLPSGEVLETSTS
GVGDLSGLPSGEVVETSTSGVEDLSGLPSGGEVLETSTSGVEDISGLPSGEVLETTASGI
EDVSELPSGEGLETSASGVEDLSRLPSGEVLETSASGVGDISGLPSGGEVLEISASGVGD
LSGLPSGGEGLETSASGVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGPASGDL
DLGKLPSGTLGSGQAPETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDS
TLVEVVTASTASELEGRGTIGISGAGEISGLPSSELDISGEASGLPSGTELSGQASGSPD
VSRETSGLFDVSGQPSGFPDTSGETSGVTELSGLPSGQPGVSGEASGVPYGSSQPFGITD
LSGETSGVPDLSGQPSGLPGFSGATSGVPDLVSGATSGSGESSDITFVDTSLVEVTPTTF
KEEEGLGSVELSGLPSGEADLSGRSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPIGIAEV
SGESSGAETGSSLPSGAYYGSELPSGFPTVSLVDRTLVESVTQAPTAQEAGEGPPGILEL
SGTHSGAPDMSGDHSGFLDVSGLQFGLVEPSGEPPSTPYFSGDFASTTDVSGESSAAMGT
NGEASGLPEVTLITSEFMEGVTEPTVSQELGQRPPVTHTPQLFESSGEASAAGDISGATP
VLPGSGVEVSSVPESSSETSAYPEAGVGASAAPETSGEDSGSPDLSETTSAFHEADLERS
SGLGVSGSTLTFQEGEPSASPEVSGESTTTGDGLLYCHDCLTVTTPYAGQWALIADFPLE
LSQLESSPRCCGSGAQEGHRPRKSADPKPASWTSGTSCPNFEVLGAMPGDCVLCSTSPLG
VAAPTRSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGWTKYQGHCYRHF
PDRETWVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTIEGDFRWSDGHP
MQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGTVACGEPPMVQH
ARTFGQKKDRYEINSLVRYQCTEGFVQRHVPTIRCQPSGHWEEPRITCTDATAYKRRLQK
RSSRHPRRSRPSTAH
Download sequence
Identical sequences ENSMMUP00000000745 9544.ENSMMUP00000015113 ENSMMUP00000015113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]