SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015116 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015116
Domain Number 1 Region: 158-262
Classification Level Classification E-value
Superfamily C-type lectin-like 1.2e-39
Family Link domain 0.009
Further Details:      
 
Domain Number 2 Region: 268-352
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-23
Family Link domain 0.0028
Further Details:      
 
Domain Number 3 Region: 49-155
Classification Level Classification E-value
Superfamily Immunoglobulin 5.42e-16
Family V set domains (antibody variable domain-like) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015116   Gene: ENSMMUG00000011517   Transcript: ENSMMUT00000016129
Sequence length 354
Comment pep:known chromosome:MMUL_1:6:79828368:79860688:-1 gene:ENSMMUG00000011517 transcript:ENSMMUT00000016129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLLLLVLISICWADHLSDNYTLDHDRVIHLQAENGPRLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDN
DASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIARVGQIFAAWKLLG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
Download sequence
Identical sequences F7C5P6
ENSMMUP00000015116 ENSMMUP00000015116 XP_001112341.1.72884 XP_001112414.1.72884 XP_014995846.1.72884 9544.ENSMMUP00000015116

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]