SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015166 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015166
Domain Number 1 Region: 572-707,784-956
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.63e-79
Family Protein kinases, catalytic subunit 0.0000000228
Further Details:      
 
Domain Number 2 Region: 223-312
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000103
Family I set domains 0.076
Further Details:      
 
Domain Number 3 Region: 330-415
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000024
Family I set domains 0.032
Further Details:      
 
Domain Number 4 Region: 34-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000325
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015166   Gene: ENSMMUG00000011557   Transcript: ENSMMUT00000016184
Sequence length 1106
Comment pep:known chromosome:MMUL_1:6:146594105:146635762:-1 gene:ENSMMUG00000011557 transcript:ENSMMUT00000016184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELILNVSSTFVLTCSGSAPV
VWERMSQELPQEMAKAQDNTFSSVLTLTNLTGLDTGEYFCTYNDSRGLEPDERKRLYIFV
PDPTMGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWMYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGALQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPMLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDMQEVIVVPHSLPFKAVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDSSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPEPQLERQV
EPEPELEQLPDSGCPAPRAEAEDSFL
Download sequence
Identical sequences XP_001107595.1.72884 9544.ENSMMUP00000015166 ENSMMUP00000015166 ENSMMUP00000015166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]