SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015186 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015186
Domain Number 1 Region: 328-430
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.45e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 56-140
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000209
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 139-193,220-235,263-275
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000154
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015186   Gene: ENSMMUG00000011566   Transcript: ENSMMUT00000016204
Sequence length 715
Comment pep:known_by_projection chromosome:MMUL_1:7:59606676:59760879:1 gene:ENSMMUG00000011566 transcript:ENSMMUT00000016204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGLDVDQKDGKTPGPIQERENH
SEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAY
KPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVH
PDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNAPL
DHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDADVGQGSK
YCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGK
DILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEI
EYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSVEKADVFFS
PDKEEKVQRIFSISSLAEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSSVVHVPGVN
DIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGIGTSHTYPA
DPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQWQSQHHGQQ
SGEQHSHQQPGQTEVFQDMLPMPGDPPREKPVPGNEWWSPHSRQHFGQPISYART
Download sequence
Identical sequences 9544.ENSMMUP00000015186 ENSMMUP00000000734 ENSMMUP00000015186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]