SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015320 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015320
Domain Number 1 Region: 737-1019
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.39e-69
Family Protein kinases, catalytic subunit 0.00000119
Further Details:      
 
Domain Number 2 Region: 554-647
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 412-500
Classification Level Classification E-value
Superfamily Immunoglobulin 3.66e-20
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 126-216
Classification Level Classification E-value
Superfamily Immunoglobulin 6.27e-18
Family I set domains 0.03
Further Details:      
 
Domain Number 5 Region: 329-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000322
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 227-317
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000267
Family I set domains 0.056
Further Details:      
 
Domain Number 7 Region: 31-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000028
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 8 Region: 509-549
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000338
Family I set domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015320   Gene: ENSMMUG00000011670   Transcript: ENSMMUT00000016350
Sequence length 1030
Comment pep:known chromosome:MMUL_1:4:42965397:43050123:1 gene:ENSMMUG00000011670 transcript:ENSMMUT00000016350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATRGSLARPRRLPLLSVLLLPLLGGTQAAIVFIKQPSSQDALQGRRALLRCEVEAPGL
VHVYWLLDGAPVQDTERRFTQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFN
IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNNTVSS
KERNLTLRPAGPEHSGLYSCCAHNAFGQACSSQNFTLSIADESFARVVLAPQDVIVARNE
EAMFHCQFSAQPPPNLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGVYR
CIGQGQRGPPVILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
VRLPTHGRVYQKGHELVLASIAESDAGVYTCHAANLAGQRRQDVNITVATVPTWLKKPQD
SQLEEGKPGYLHCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINNVEVYDGTWYR
CVSSTPAGSIEAQARVQVLDGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQI
RAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPR
MHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEESEGPGSPPPYK
MIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPS
AEIQEEVALTSLGSGPTATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEE
GVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDL
GDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSA
QRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVF
THGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLFRLMQRCWALSPKDRPSFSEIAST
LGDSPVDSKP
Download sequence
Identical sequences F7HGS3
ENSMMUP00000015320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]