SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015321 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015321
Domain Number 1 Region: 721-1003
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.25e-69
Family Protein kinases, catalytic subunit 0.00000119
Further Details:      
 
Domain Number 2 Region: 412-501
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-20
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 126-216
Classification Level Classification E-value
Superfamily Immunoglobulin 6.15e-18
Family I set domains 0.03
Further Details:      
 
Domain Number 4 Region: 502-589
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000179
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 329-418
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000308
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 227-317
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000267
Family I set domains 0.056
Further Details:      
 
Domain Number 7 Region: 31-110
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000261
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 8 Region: 585-628
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000011
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015321   Gene: ENSMMUG00000011670   Transcript: ENSMMUT00000016351
Sequence length 1014
Comment pep:known chromosome:MMUL_1:4:42965397:43050123:1 gene:ENSMMUG00000011670 transcript:ENSMMUT00000016351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGATRGSLARPRRLPLLSVLLLPLLGGTQAAIVFIKQPSSQDALQGRRALLRCEVEAPGL
VHVYWLLDGAPVQDTERRFTQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFN
IKWIEAGPVVLKHPASEAEIQPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNNTVSS
KERNLTLRPAGPEHSGLYSCCAHNAFGQACSSQNFTLSIADESFARVVLAPQDVIVARNE
EAMFHCQFSAQPPPNLQWLFEDETPITNRSRPPHLRRATVFANGSLLLTQVRPRNAGVYR
CIGQGQRGPPVILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAG
VRLPTHGRVYQKGHELVLASIAESDAGVYTCHAANLAGQRRQDVNITVATVPTWLKKPQD
SQLEEGKPGYLHCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINNVEVYDGTWYR
CVSSTPAGSIEAQARVQVLEKLKFTPPPQPQQCMEFDKEATVPCSATGREKPTIKWERAD
GSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER
TTVYQGHTALLQCEAQGDPKPLIQWKDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYI
IAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGP
TATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKD
EQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEK
LKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVY
NSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVL
ADLQAGKARLPQPEGCPSKLFRLMQRCWALSPKDRPSFSEIASTLGDSPVDSKP
Download sequence
Identical sequences F7HGR6
ENSMMUP00000015321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]