SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015324 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015324
Domain Number 1 Region: 696-978
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.11e-69
Family Protein kinases, catalytic subunit 0.00000119
Further Details:      
 
Domain Number 2 Region: 386-475
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-20
Family I set domains 0.024
Further Details:      
 
Domain Number 3 Region: 100-190
Classification Level Classification E-value
Superfamily Immunoglobulin 5.87e-18
Family I set domains 0.03
Further Details:      
 
Domain Number 4 Region: 476-563
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000163
Family I set domains 0.018
Further Details:      
 
Domain Number 5 Region: 303-392
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000306
Family I set domains 0.018
Further Details:      
 
Domain Number 6 Region: 201-291
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000253
Family I set domains 0.056
Further Details:      
 
Domain Number 7 Region: 5-84
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000259
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 
Domain Number 8 Region: 558-602
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000125
Family I set domains 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015324   Gene: ENSMMUG00000011670   Transcript: ENSMMUT00000016354
Sequence length 989
Comment pep:known chromosome:MMUL_1:4:43017351:43049275:1 gene:ENSMMUG00000011670 transcript:ENSMMUT00000016354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GTQAAIVFIKQPSSQDALQGRRALLRCEVEAPGLVHVYWLLDGAPVQDTERRFTQGSSLS
FAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEIQPQTQV
TLRCHIDGHPRPTYQWFRDGTPLSDGQSNNTVSSKERNLTLRPAGPEHSGLYSCCAHNAF
GQACSSQNFTLSIADESFARVVLAPQDVIVARNEEAMFHCQFSAQPPPNLQWLFEDETPI
TNRSRPPHLRRATVFANGSLLLTQVRPRNAGVYRCIGQGQRGPPVILEATLHLAEIEDMP
LFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAGVRLPTHGRVYQKGHELVLASIAESDA
GVYTCHAANLAGQRRQDVNITVATVPTWLKKPQDSQLEEGKPGYLHCLTQATPKPTVVWY
RNQMLISEDSRFEVFKNGTLRINNVEVYDGTWYRCVSSTPAGSIEAQARVQVLEKLKFTP
PPQPQQCMEFDKEATVPCSATGREKPTIKWERADGSSLPEWVTDNAGTLHFARVTRDDAG
NYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQGDPKPLIHWD
PDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEG
EEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPTATNKRHSTSDKMHFPRSSLQPITT
LGKSEFGEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRL
LGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHL
SNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMSPEAILEG
DFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLFRLMQ
RCWALSPKDRPSFSEIASTLGDSPVDSKP
Download sequence
Identical sequences ENSMMUP00000015324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]