SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015327 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015327
Domain Number 1 Region: 127-385
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.45e-65
Family Protein kinases, catalytic subunit 0.00000203
Further Details:      
 
Domain Number 2 Region: 6-94
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000114
Family I set domains 0.018
Further Details:      
 
Domain Number 3 Region: 90-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000568
Family I set domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015327   Gene: ENSMMUG00000011670   Transcript: ENSMMUT00000016357
Sequence length 396
Comment pep:known chromosome:MMUL_1:4:42965379:43050124:1 gene:ENSMMUG00000011670 transcript:ENSMMUT00000016357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLFEPRVFTAGSEERVTCLPPKGLPEPSVWWEHAGVRLPTHGRVYQKGHELVLASIAES
DAGVYTCHAANLAGQRRQDVNITVATVPTWLKKPQDSQLEEGKPGYLHCLTQATPKPTVV
WYRNQMLISEDSRFEVFLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLN
HANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQV
ALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPLRWMS
PEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPS
KLFRLMQRCWALSPKDRPSFSEIASTLGDSPVDSKP
Download sequence
Identical sequences ENSMMUP00000015327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]