SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015350 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015350
Domain Number 1 Region: 143-268
Classification Level Classification E-value
Superfamily FKBP-like 4.71e-39
Family FKBP immunophilin/proline isomerase 0.00041
Further Details:      
 
Domain Number 2 Region: 40-154
Classification Level Classification E-value
Superfamily FKBP-like 1.2e-38
Family FKBP immunophilin/proline isomerase 0.00017
Further Details:      
 
Domain Number 3 Region: 266-379
Classification Level Classification E-value
Superfamily FKBP-like 4.52e-37
Family FKBP immunophilin/proline isomerase 0.00029
Further Details:      
 
Domain Number 4 Region: 374-478
Classification Level Classification E-value
Superfamily FKBP-like 1.81e-33
Family FKBP immunophilin/proline isomerase 0.00037
Further Details:      
 
Domain Number 5 Region: 484-559
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000632
Family Calbindin D9K 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015350   Gene: ENSMMUG00000011694   Transcript: ENSMMUT00000016381
Sequence length 570
Comment pep:known chromosome:MMUL_1:3:93159484:93208017:-1 gene:ENSMMUG00000011694 transcript:ENSMMUT00000016381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRGWRPPPPPLLLLLLWVTGQAAPVAGLGSDAELQIERRFVPDECPRTVRSGDFVRYH
YVGTFPDGQKFDSSYDRDSTFNVFVGKGQLITGMDQALVGMCVNERRFVKIPPKLAYGSE
GVSGVIPPNSVLHFDVLLMDIWNSEDQVQIHTYFKPPSCPRTIQVSDFVRYHYNGTFLDG
TLFDSSHNRMKTYDTYVGIGWLIPGMDKGLLGMCVGEKRIITIPPFLAYGEDGDGKDIPG
QASLVFDVALLDLHNPKDSISIENKVVPENCERISQSGDFLRYHYNGTLLDGTLFDSSYS
RNRTFDTYIGQGYVIPGMDEGLLGVCIGEKRRIVVPPHLGYGEEGRGNIPGSAVLVFDIH
VIDFHNPSDSISITSHYKPPDCSVLSKKGDYLKYHYNASLLDGTLLDSTWNLGKTYNIVL
GSGQVVLGMDMGLREMCVGEKRTVIIPPHLGYGEAGVDGEVPGSAVLVFDIELLELVAGL
PEGYMFIWNGEVSPNLFEEIDKDGNGEVLLEEFSEYIHAQVASGKGKLAPGFDAELVVKN
MFTNQDRNGDGKVTAEEFKLKDQEAKHDEL
Download sequence
Identical sequences A0A0D9RQS4 I0FJL0
ENSMMUP00000015350 ENSMMUP00000015350 XP_014989236.1.72884 9544.ENSMMUP00000015350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]