SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015373 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015373
Domain Number 1 Region: 128-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.51e-18
Family Complement control module/SCR domain 0.0000444
Further Details:      
 
Domain Number 2 Region: 189-250
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.01e-16
Family Complement control module/SCR domain 0.0000171
Further Details:      
 
Domain Number 3 Region: 2-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000153
Family Complement control module/SCR domain 0.0000602
Further Details:      
 
Domain Number 4 Region: 64-138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000131
Family Complement control module/SCR domain 0.0000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015373   Gene: ENSMMUG00000011711   Transcript: ENSMMUT00000016407
Sequence length 343
Comment pep:known_by_projection chromosome:MMUL_1:1:163001999:163037745:-1 gene:ENSMMUG00000011711 transcript:ENSMMUT00000016407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCGPPPAVPNAQPALKGLTSFPENTVITYRCDENFMKIPGKQDSVMCLPDSQWSDIEEFC
NRNCGAPTRLKFASLKQLYIPQSYFPVGTVVEYECRPGYRRDPSLLAKLTCLQNLKWSTA
AEFCKKKSCPNPGEIPNGQIDTSNGILFGAAISFSCNTGYKLFGPTSSLCLVSGSGVQWS
DTLPECREIYCPAPPQIDNGIIQGEREHYGYRQSITYLCNRGFTMIGEHSIYCTVNDDEG
EWSGPPPACRANSLVSKAPPTVQKPTTVNVRTTEVSPTSQKTTTPNAQATRSTPASRTTK
HFHKTTPDKGSGTSSGATHLLSGYTCFTLTGLLGTLVTMGWLT
Download sequence
Identical sequences 9544.ENSMMUP00000015373 ENSMMUP00000015373 ENSMMUP00000015373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]