SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015483 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015483
Domain Number 1 Region: 119-266
Classification Level Classification E-value
Superfamily Tubulin C-terminal domain-like 2.96e-62
Family Tubulin, C-terminal domain 0.0000000688
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 4.71e-48
Family Tubulin, GTPase domain 0.000000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015483   Gene: ENSMMUG00000021081   Transcript: ENSMMUT00000016528
Sequence length 287
Comment pep:known chromosome:MMUL_1:11:46312405:46314190:-1 gene:ENSMMUG00000021081 transcript:ENSMMUT00000016528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGKH
VPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDR
IRKLTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKY
MACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQ
RAVCMLSNTTAIAEAWARLDHKFDLIRIMRRLVWILLKERVRKKERN
Download sequence
Identical sequences ENSMMUP00000015483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]