SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015533 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015533
Domain Number 1 Region: 48-193
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.86e-16
Family Ankyrin repeat 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015533
Domain Number - Region: 322-563
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000165
Family Voltage-gated potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015533   Gene: ENSMMUG00000011835   Transcript: ENSMMUT00000016582
Sequence length 657
Comment pep:known_by_projection chromosome:MMUL_1:14:100074966:100111646:-1 gene:ENSMMUG00000011835 transcript:ENSMMUT00000016582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSRGSDNRLAHRRQTVLREKGRRLANRGPAYMFSDCSTSLSIEEERFLDAAEYGNVPVVR
KMLEECHSLNVNCVDYMGQNALQLAVANEHLEITELLLKKENLSRVGDALLLAISKGYVR
IVEAILSHPAFAEGKRLATSPSQSELQQDDFYAYDEDGTRFSHDVTPIILAAHCQEYEIV
HTLLRKGARIERPHDYFCKCNDCNQKQKHDSFSHSRSRINAYKGLASPAYLSLSSEDPVM
TALELSNELAVLANIEKEFKMGKIMRGPFMKFVAHAASFTIFLGLLVMNAADRFEGTKLL
PNETSTDNAKQLFRMKTSCFSWMEMLIISWVIGMIWAECKEIWTQGPKEYLFELWNMLDF
GMLAIFAASFIARFMAFWHASKAQSIIDANDTLKDLTKVTLGDNVKYYNLARIKWDPSDP
QIISEGLYAIAVVLSFSRIAYILPANESFGPLQISLGRTVKDIFKFMVIFIMVFVAFMIG
MFNLYSYYIGAKQNEAFTTVEESFKTLFWAIFGLSEVKSVVINYNHKFIENIGYVLYGVY
NVTMVIVLLNMLIAMINSSFQEIEDESMDCSSPFVHSLFYTFDQGEHFPVPFNLVPSPKS
LFYLLLKLKKWISELFQGHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQV
Download sequence
Identical sequences ENSMMUP00000015533 9544.ENSMMUP00000015533 ENSMMUP00000015533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]