SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015573 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015573
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.89e-40
Family Band 7/SPFH domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015573
Domain Number - Region: 208-320
Classification Level Classification E-value
Superfamily ALDH-like 0.0392
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015573   Gene: ENSMMUG00000011864   Transcript: ENSMMUT00000016624
Sequence length 356
Comment pep:known chromosome:MMUL_1:15:42448865:42452409:1 gene:ENSMMUG00000011864 transcript:ENSMMUT00000016624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGSLQASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVSAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKPPVPGTPDSVSSGNSRDVQGTDASLDEELDRVKMS
Download sequence
Identical sequences A0A0D9RD34 A0A2K6DZC4 A0A2K6MUP3 A0A2K6NJS4 G7NFE6 G7PS14
ENSMMUP00000015573 9544.ENSMMUP00000015573 NP_001247811.1.72884 XP_005581468.1.63531 XP_007967056.1.81039 XP_010384127.1.97406 XP_011746417.1.29376 XP_011805867.1.43180 XP_011835490.1.47321 XP_011942437.1.92194 XP_017721071.1.44346 XP_017721072.1.44346 ENSMMUP00000015573 ENSPANP00000019115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]