SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015584 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015584
Domain Number 1 Region: 106-226
Classification Level Classification E-value
Superfamily C-type lectin-like 3.32e-30
Family C-type lectin domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015584   Gene: ENSMMUG00000011872   Transcript: ENSMMUT00000016635
Sequence length 229
Comment pep:known chromosome:MMUL_1:13:3129497:3147685:1 gene:ENSMMUG00000011872 transcript:ENSMMUT00000016635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQPVMAASDISKRKHTSSFVEMGSQGDVGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGP
PGPNGEPGLPCECSQLRKAIGEMDNQVSQLTSELKFIKNAVAGVRETDSKIYLLVKEEKR
YADAQLSCQGRGGTLGMPKDEAANGLMAAYLAQAGLARVFIGINDLEREGAFVYSDRSPM
RTFNKWRSGEPNNAYDEEDCVEMVASGGWNDVACHTTMYFMCEFDKESM
Download sequence
Identical sequences ENSMMUP00000015584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]