SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015674 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000015674
Domain Number - Region: 52-107
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015674   Gene: ENSMMUG00000011954   Transcript: ENSMMUT00000016739
Sequence length 211
Comment pep:known chromosome:MMUL_1:15:51393181:51395218:1 gene:ENSMMUG00000011954 transcript:ENSMMUT00000016739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPMWRMRGGATRRGSCCGGDGTVASRGPGRSGRTRGGGNSTSGGGVGWRGRADGARQQL
EERFADLAASHLEAIRARDEWDRQNARLRQENARLRLENRRLKRENRSLFRQALRLPGEG
GDGTPAEALRVPEEASTNRRATDSGPEDEPGSPRALRARLEKLEAMYRRALLQLHLEQRG
PRTSGDKEEQPLQEPASGFRSQDSEPSGSWL
Download sequence
Identical sequences F7HID6
9544.ENSMMUP00000015674 ENSMMUP00000015674 ENSMMUP00000015674 NP_001252552.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]