SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015701 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015701
Domain Number 1 Region: 113-284
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.59e-52
Family NadC C-terminal domain-like 0.000027
Further Details:      
 
Domain Number 2 Region: 8-112
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 1.02e-25
Family NadC N-terminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015701   Gene: ENSMMUG00000011969   Transcript: ENSMMUT00000016766
Sequence length 296
Comment pep:known chromosome:MMUL_1:20:27644976:27647586:1 gene:ENSMMUG00000011969 transcript:ENSMMUT00000016766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPPGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAVLWAKSPGVLAGRPFFD
AIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHSLLLGERVALNTLARCSGIASAAAAA
VEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGV
EKAVRAARQAADFALKVEVECSSLQEAVQAAEAGADLVLLDNFKPKELHPTAAALKAQFP
SVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEAAPVPKIH
Download sequence
Identical sequences F7H283
ENSMMUP00000015701 ENSMMUP00000015701 9544.ENSMMUP00000015701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]