SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016005 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016005
Domain Number 1 Region: 271-366
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000131
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.005
Further Details:      
 
Domain Number 2 Region: 100-161
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000458
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.069
Further Details:      
 
Domain Number 3 Region: 15-56
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000968
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016005   Gene: ENSMMUG00000012203   Transcript: ENSMMUT00000017091
Sequence length 828
Comment pep:known_by_projection chromosome:MMUL_1:3:108777649:108811511:-1 gene:ENSMMUG00000012203 transcript:ENSMMUT00000017091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKPIPAEGIKSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAKSF
FDVALKSSPAERNGGQENCRAANFREGLNLQEGEFLLQALNGFVLVVTTDALVFYASSTI
QDYLGFQQSDVIHQSVYELIHTEDRAEFQRQLHWALNPSQCTESGQGIDEAPGLPQPVVC
YNADQIPPENSPFMERCFICRLRCLLDNSSGFLAMNFQGRLKYLHGQKKKGKDGSILPPQ
LALFAIATPLQPPSILEIRTKNFIFRTKHKLDFTPIGCDAKGRIVLGYTEAELCTRGSGY
QFIHAADMLYCAESHIRMIKTGESGLIVFRLLTKNNRWTWVQSNARLLYKNGRPDYIIAT
QRPLTDEEGSEHLRKRNTKLPFMFTTGEALLYEATNPFPAIMDPLPLRTKNGTSEKDSAT
KSTLNKDSLNPSSLLAAVMQQDESIYLYPASSTSSTAPFENNFFNESMNECRNWEDNTAP
MGNDTILKHEQIDQPQDVNSFAGGHLGLFQDSKNSDLYSIMKNLGIDFEDIKHMQNEKFF
RNDFSGEVDFRDIDLTDEILTYIQDSLSKSPFIPSDYQQQQSLALNSSCMVQEHLQLEQQ
QQQQHHQKQAVVEPQQQLCQKMKHMQVNGMFANWSADQFVPFSCPRQDPQQYNVFSDLHG
INQEFPYKSEMDPVPYTQNFISCNQPVLPQHSKCTELDYPMGSYEPSPYPTTSSLEDFVT
CLQVPENQKHGLNPQSAIVTPQTCYAGAMSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLN
KVRNGVLNETYPAELNNINNTQVTTHLQPLHHPSEARPFPDLTSGGFL
Download sequence
Identical sequences 9544.ENSMMUP00000016005 ENSMMUP00000016005 ENSMMUP00000016005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]