SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016011 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016011
Domain Number 1 Region: 129-230
Classification Level Classification E-value
Superfamily Immunoglobulin 3.6e-21
Family I set domains 0.0094
Further Details:      
 
Domain Number 2 Region: 414-513
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 324-420
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 4 Region: 42-132
Classification Level Classification E-value
Superfamily Immunoglobulin 6.23e-18
Family I set domains 0.0098
Further Details:      
 
Domain Number 5 Region: 275-329
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000151
Family I set domains 0.02
Further Details:      
 
Domain Number 6 Region: 4-45
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000516
Family I set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016011   Gene: ENSMMUG00000012208   Transcript: ENSMMUT00000017097
Sequence length 515
Comment pep:novel chromosome:MMUL_1:15:8487297:8517945:-1 gene:ENSMMUG00000012208 transcript:ENSMMUT00000017097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDAQGTLIIQGVAPEDAGNYSCQATNEVGTDQETVTLYYTDPPSVSAVNAVVLVAVGEEA
VLVCKASGVPPPRVIWYRGVLMVLCLAFLVIVPTMISGKLRIPVAQERDAGIYTCRAVNE
LGDASAEIQLAVGHAPQLTELPRDVTVELGRSALLACRATGRPPPMVTWRRGDGQPLGLR
LGAGRGSKSRQPDSGVLFFENVAPEDQALYVCEARNVFGKVQAEAQLIVTGHGSLVDLRA
QVGSGYAGVRPTQPCRVSGGLVRPEAKLVLPHPYQLPSGNRHSIRADGSLHLDRALQEHA
GRYRCVATNTAGSRHRDVELVVQVPPRIHPTATHHITNEGVPASLPCVASGVPTPTITWT
KETNALTSRGPHYNVSKEGTLLIAQPSAQDTGAYVCTATNTVGFSSQEMRLSVNTKPRIH
MNGSHNADVPLRVTAKAGEEVTLDCEAEGSPPPLVTWTKDSHPVPPITNRHGLLPSGSLR
LAQVQVGDSGHYECTASNPAGSTSRRYVLGVQGRT
Download sequence
Identical sequences 9544.ENSMMUP00000016011 ENSMMUP00000016011 ENSMMUP00000016011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]