SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016052 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016052
Domain Number 1 Region: 44-202
Classification Level Classification E-value
Superfamily E set domains 7.28e-55
Family RhoGDI-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016052   Gene: ENSMMUG00000012239   Transcript: ENSMMUT00000017140
Sequence length 206
Comment pep:known chromosome:MMUL_1:16:23741453:23747183:-1 gene:ENSMMUG00000012239 transcript:ENSMMUT00000017140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIR
DMDSGTVLFEIKKPPASERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDK
PVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYET
QSDSFYFVDDRLVMHNKADYSYSGTP
Download sequence
Identical sequences ENSMMUP00000016053 ENSMMUP00000016052 9544.ENSMMUP00000016052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]