SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016184 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016184
Domain Number 1 Region: 1448-1622
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-28
Family Fibronectin type III 0.0000436
Further Details:      
 
Domain Number 2 Region: 1814-1981
Classification Level Classification E-value
Superfamily Fibronectin type III 3.37e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 908-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 8.6e-25
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 4 Region: 1264-1437
Classification Level Classification E-value
Superfamily Fibronectin type III 3.85e-23
Family Fibronectin type III 0.00000789
Further Details:      
 
Domain Number 5 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 9.14e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 6 Region: 1633-1804
Classification Level Classification E-value
Superfamily Fibronectin type III 2.32e-20
Family Fibronectin type III 0.00092
Further Details:      
 
Domain Number 7 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 2.68e-20
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 8 Region: 1172-1260
Classification Level Classification E-value
Superfamily Fibronectin type III 6.15e-17
Family Fibronectin type III 0.0000028
Further Details:      
 
Domain Number 9 Region: 726-890
Classification Level Classification E-value
Superfamily Fibronectin type III 5.45e-16
Family Fibronectin type III 0.00099
Further Details:      
 
Domain Number 10 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000824
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 11 Region: 2248-2291
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000017
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 12 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000301
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 13 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000357
Family Fibronectin type III 0.00000305
Further Details:      
 
Domain Number 14 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000127
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 15 Region: 472-511
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000017
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 16 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000284
Family Fibronectin type I module 0.0000611
Further Details:      
 
Domain Number 17 Region: 2203-2246
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000458
Family Fibronectin type I module 0.004
Further Details:      
 
Domain Number 18 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000602
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 19 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000288
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 20 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 21 Region: 2291-2332
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000157
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 22 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000034
Family Fibronectin type I module 0.00035
Further Details:      
 
Domain Number 23 Region: 2117-2181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000578
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 24 Region: 1091-1179
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000187
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016184   Gene: ENSMMUG00000012321   Transcript: ENSMMUT00000017280
Sequence length 2385
Comment pep:known chromosome:MMUL_1:12:79175763:79251730:-1 gene:ENSMMUG00000012321 transcript:ENSMMUT00000017280 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMIQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALICTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVREAVYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYSGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVQVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPLSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYEISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVCILTFVDPSAGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIFAVEENQESTPVFIQQETTGT
PRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTF
AEVTGLSPGVTYYFKVFAVNHGRESKPLTAEQTTKLDAPTNLQFVNETDSTVLVRWTPPR
ARITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATGV
FTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLETNPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISD
TIIPEVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVG
YYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTGLDSPTGIDFSDITANSFTVHWIAP
RATITGYRIRHHPEHMSGRPREDRVPPSRNSITLTNLTPGTEYVVSIVALNGREESPLLI
GQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS
TATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISVK
WLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVFAQNPNGES
QPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPD
GEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQ
WTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTS
RPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPVQRTI
KPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLV
SWQPPRARITGYIIKYEKPGSSPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQK
SEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITHPGYDTGNGIQLPGTSG
QQPTVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGEEIQIGHIPREDVDYHLYPH
GLGLNPNASTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTG
LTRGATYNIIVEALKDQQRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEW
ERMSESGFKLLCHCLGFGSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGN
GKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPS
PEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences ENSMMUP00000016184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]