SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016195 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016195
Domain Number 1 Region: 1359-1530
Classification Level Classification E-value
Superfamily Fibronectin type III 1.19e-27
Family Fibronectin type III 0.00000868
Further Details:      
 
Domain Number 2 Region: 1814-1981
Classification Level Classification E-value
Superfamily Fibronectin type III 1.67e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 908-1078
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-24
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 4 Region: 1542-1707
Classification Level Classification E-value
Superfamily Fibronectin type III 7.23e-24
Family Fibronectin type III 0.0000113
Further Details:      
 
Domain Number 5 Region: 1174-1346
Classification Level Classification E-value
Superfamily Fibronectin type III 6.19e-21
Family Fibronectin type III 0.00000755
Further Details:      
 
Domain Number 6 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 8.28e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 7 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 2.46e-20
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 8 Region: 1719-1809
Classification Level Classification E-value
Superfamily Fibronectin type III 2.51e-19
Family Fibronectin type III 0.00000341
Further Details:      
 
Domain Number 9 Region: 726-890
Classification Level Classification E-value
Superfamily Fibronectin type III 6.46e-16
Family Fibronectin type III 0.00099
Further Details:      
 
Domain Number 10 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000759
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 11 Region: 2072-2116
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000249
Family Fibronectin type I module 0.0017
Further Details:      
 
Domain Number 12 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000288
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 13 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000324
Family Fibronectin type III 0.00000305
Further Details:      
 
Domain Number 14 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000116
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 15 Region: 472-511
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000157
Family Fibronectin type I module 0.0019
Further Details:      
 
Domain Number 16 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000254
Family Fibronectin type I module 0.0000611
Further Details:      
 
Domain Number 17 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000055
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 18 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000262
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 19 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000314
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 20 Region: 2116-2157
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000144
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 21 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000314
Family Fibronectin type I module 0.00035
Further Details:      
 
Domain Number 22 Region: 1998-2061
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000649
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 23 Region: 1091-1179
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000017
Family Fibronectin type III 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016195   Gene: ENSMMUG00000012321   Transcript: ENSMMUT00000017291
Sequence length 2210
Comment pep:known chromosome:MMUL_1:12:79175763:79251730:-1 gene:ENSMMUG00000012321 transcript:ENSMMUT00000017291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMIQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALICTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVREAVYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYSGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVQVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPLSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYEISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVCILTFVDPSAGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIFAVEENQESTPVFIQQETTGT
PRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTF
AEVTGLSPGVTYYFKVFAVNHGRESKPLTAEQTTKLDAPTNLQFVNETDSTVLVRWTPPR
ARITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATGV
FTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLETNPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKESVPISD
TIIPAVPPPTDLRFTNIGPDTMRVTWAPPPSIDLTNFLVRYSPVKNEEDVAELSISPSDN
AVVLTNLLPGTEYVVSVSSVYEQHESTPLRGRQKTGLDSPTGIDFSDITANSFTVHWIAP
RATITGYRIRHHPEHMSGRPREDRVPPSRNSITLTNLTPGTEYVVSIVALNGREESPLLI
GQQSTVSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKS
TATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTDVQDNSISVK
WLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSVFAQNPNGES
QPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPD
GEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPTDLKFTQVTPTSLSAQ
WTPPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTS
RPAQGVVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAVPANGQTPVQRTI
KPDVRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLV
SWQPPRARITGYIIKYEKPGSSPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQK
SEPLIGRKKTGQEALSQTTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTG
LTRGATYNIIVEALKDQQRHKVREEVVTVGNSGWCHDNGVNYKIGEKWDRQGENGQMMSC
TCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRP
GGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences ENSMMUP00000016195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]