SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016228 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016228
Domain Number 1 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 1.91e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 2 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 5.71e-21
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 3 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000017
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 4 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000654
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 5 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000275
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 6 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000353
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 7 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000536
Family Fibronectin type I module 0.00011
Further Details:      
 
Domain Number 8 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000131
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 9 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000615
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 10 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000733
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 11 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000746
Family Fibronectin type I module 0.00035
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016228
Domain Number - Region: 618-649
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0107
Family Fibronectin type III 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016228   Gene: ENSMMUG00000012321   Transcript: ENSMMUT00000017326
Sequence length 657
Comment pep:known chromosome:MMUL_1:12:79228285:79251739:-1 gene:ENSMMUG00000012321 transcript:ENSMMUT00000017326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMIQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALICTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVREAVYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYSGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVQVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPVSIPPRNLGY
Download sequence
Identical sequences ENSMMUP00000016228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]