SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016231 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016231
Domain Number 1 Region: 1493-1660
Classification Level Classification E-value
Superfamily Fibronectin type III 2.25e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 2 Region: 1311-1483
Classification Level Classification E-value
Superfamily Fibronectin type III 3.61e-25
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 3 Region: 908-1077
Classification Level Classification E-value
Superfamily Fibronectin type III 6.29e-25
Family Fibronectin type III 0.00049
Further Details:      
 
Domain Number 4 Region: 408-463
Classification Level Classification E-value
Superfamily Kringle-like 7.42e-21
Family Fibronectin type II module 0.0000458
Further Details:      
 
Domain Number 5 Region: 348-403
Classification Level Classification E-value
Superfamily Kringle-like 2.2e-20
Family Fibronectin type II module 0.0000652
Further Details:      
 
Domain Number 6 Region: 1086-1253
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-16
Family Fibronectin type III 0.00000759
Further Details:      
 
Domain Number 7 Region: 726-890
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-16
Family Fibronectin type III 0.00099
Further Details:      
 
Domain Number 8 Region: 557-603
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000068
Family Fibronectin type I module 0.0024
Further Details:      
 
Domain Number 9 Region: 1871-1914
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000144
Family Fibronectin type I module 0.0016
Further Details:      
 
Domain Number 10 Region: 515-559
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000249
Family Fibronectin type I module 0.0044
Further Details:      
 
Domain Number 11 Region: 618-700
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000292
Family Fibronectin type III 0.00000305
Further Details:      
 
Domain Number 12 Region: 230-274
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000105
Family Fibronectin type I module 0.0001
Further Details:      
 
Domain Number 13 Region: 467-508
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000131
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 14 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000239
Family Fibronectin type I module 0.0000611
Further Details:      
 
Domain Number 15 Region: 1826-1869
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000379
Family Fibronectin type I module 0.0047
Further Details:      
 
Domain Number 16 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000497
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 17 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000236
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 18 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000275
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 19 Region: 1914-1955
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000124
Family Fibronectin type I module 0.0026
Further Details:      
 
Domain Number 20 Region: 1728-1804
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000148
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 21 Region: 306-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000288
Family Fibronectin type I module 0.00035
Further Details:      
 
Domain Number 22 Region: 1254-1323
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000581
Family Fibronectin type III 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016231   Gene: ENSMMUG00000012321   Transcript: ENSMMUT00000017329
Sequence length 2008
Comment pep:known chromosome:MMUL_1:12:79175755:79251465:-1 gene:ENSMMUG00000012321 transcript:ENSMMUT00000017329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGLLLLAVLCLGTAVPSTGASKSKRQAQQMIQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALICTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGSGRITCTSRNRCNDQDTRTSY
RIGDTWSKKDNRGNLLQCICTGNGRGEWKCERHTTVQTTSSGSGPFTDVREAVYQPQPHP
QPAPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCMCLGNGVSCQETAVTQTYSGNSNGEPC
VLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALC
HFPFLYNNHNYTDCTSEGRRDNMKWCGTTQNYDADQKFGFCPMAAHEEICTTNEGVMYRI
GDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHM
LNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQ
PLQTYPSSSGPVQVFITETPSQPNSHPIQWNAPQPSHISKYILRWRPKNSVGRWKEATIP
GHLNSYTIKGLKPGVVYEGQLISIQQYGHREVTRFDFTTTSTSTPVTSNTVTGETTPLSP
LVATSESVTEITASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDL
LPGRKYIVNVYEISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVCILTFVDPSAGY
RIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIFAVEENQESTPVFIQQETTGT
PRSDTVPSPRDLQFVEVTDVKVTIMWTPPESAVTGYRVDVIPVNLPGEHGQRLPISRNTF
AEVTGLSPGVTYYFKVFAVNHGRESKPLTAEQTTKLDAPTNLQFVNETDSTVLVRWTPPR
ARITGYRLTVGLTRRGQPRQYNVGPSVSKYPLRNLQPGSEYTVSLVAIKGNQESPKATGV
FTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVS
GLTPGVEYVYTIQVLRDGQERDAPIVNKVVTPLSPPTNLHLETNPDTGVLTVSWERSTTP
DITGYRITTTPTNGQQGYSLEEVVHADQSSCTFDNLSPGLEYNVSVYTVKDDKERNSPVQ
EFTVPGSKSTATISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRTEIDKPSQMQVTD
VQDNSISVKWLPSSSPVTGYRVTTTPKNGPGPTKTKTAGPDQTEMTIEGLQPTVEYVVSV
FAQNPNGESQPLVQTAVTTIPAPTDLKFTQVTPTSLSAQWTPPNVQLTGYRVRVTPKEKT
GPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDTLTSRPAQGVVTTLENVSPPRRARV
TDATETTITISWRTKTETITGFQVDAVPANGQTPVQRTIKPDVRSYTITGLQPGTDYKIY
LYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNSLLVSWQPPRARITGYIIKYEKPGS
SPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTVQKTPFITHPG
YDTGNGIQLPGTSGQQPTVGQQMIFEEHGFRRTTPPTTATPIRHRPRPYPPNVGQEALSQ
TTISWAPFQDTSEYIISCHPVGTDEEPLQFRVPGTSTSATLTGLTRGATYNIIVEALKDQ
QRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAVGDEWERMSESGFKLLCHCLGF
GSGHFRCDSSRWCHDNGVNYKIGEKWDRQGENGQMMSCTCLGNGKGEFKCDPHEATCYDD
GKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGGEPSPEGTTGQSYNQYSQRYH
QRTNTNVNCPIECFMPLDVQADREDSRE
Download sequence
Identical sequences ENSMMUP00000016231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]