SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016291 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016291
Domain Number 1 Region: 33-117
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.58e-23
Family Ribosomal L11/L12e N-terminal domain 0.0000259
Further Details:      
 
Domain Number 2 Region: 106-180
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000000000549
Family Ribosomal protein L11, C-terminal domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016291   Gene: ENSMMUG00000012409   Transcript: ENSMMUT00000017396
Sequence length 197
Comment pep:known_by_projection chromosome:MMUL_1:1:18581636:18583216:1 gene:ENSMMUG00000012409 transcript:ENSMMUT00000017396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KQIAKLESVQSPRCNFLRLSRIRVHPTPAASTMPLKFPNKIKVVYLRCTGGERGTTSALA
AKIGPLGLSPKKVGGNIAKATDDWKGLKITVKPTIQNRQAQIEVVPSASAPIFEALKEPS
TDRKKQKNIKHRGNNITFDEIVNIARQMSHRSLARELSGTIKEILGTAQSVGCNVDGRHP
HDMIDDINSGAVKCPAS
Download sequence
Identical sequences ENSMMUP00000016291 ENSMMUP00000016291 9544.ENSMMUP00000016291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]