SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016314 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016314
Domain Number 1 Region: 193-478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-81
Family Protein kinases, catalytic subunit 0.000000157
Further Details:      
 
Domain Number 2 Region: 5-85
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000826
Family I set domains 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016314   Gene: ENSMMUG00000012424   Transcript: ENSMMUT00000017420
Sequence length 495
Comment pep:known_by_projection chromosome:MMUL_1:1:135425291:135491995:1 gene:ENSMMUG00000012424 transcript:ENSMMUT00000017420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVN
NGNYTLLAANPFGQASASIMAAFMDNPFEFNPEDPIPDTNSTSGDPVEKKDETPFGVSVA
VGLAVFACLFLSMLLLVLNKCGRRNKFGINRPAVLAPEDGLAMSLHFMTLGGSSLSPTEG
KGSGLQGHIIENPQYFSDACVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLV
AVKALKEVSESARQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFL
RSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQG
LVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIF
TYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARL
QALAQAPPVYLDVLG
Download sequence
Identical sequences ENSMMUP00000016314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]