SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016401 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016401
Domain Number 1 Region: 1-201
Classification Level Classification E-value
Superfamily Formyltransferase 1.96e-51
Family Formyltransferase 0.00000000272
Further Details:      
 
Domain Number 2 Region: 205-308
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.35e-23
Family Post formyltransferase domain 0.0000013
Further Details:      
 
Domain Number 3 Region: 416-494
Classification Level Classification E-value
Superfamily ALDH-like 0.0000000000000018
Family ALDH-like 0.0007
Further Details:      
 
Domain Number 4 Region: 327-405
Classification Level Classification E-value
Superfamily ACP-like 0.00000432
Family Acyl-carrier protein (ACP) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016401   Gene: ENSMMUG00000012488   Transcript: ENSMMUT00000017514
Sequence length 507
Comment pep:known chromosome:MMUL_1:2:45883056:45964074:-1 gene:ENSMMUG00000012488 transcript:ENSMMUT00000017514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIAVIGQSLFGQEVYGHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKFSRWR
AKGQALPEVVAKYQALGAELNVLPFCSQFIPMEIINAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFSIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGKAPRLPQPEEGATYEGIQKKETAKIDWDQPAEAIHNWIRGNDKVPGAWTEACEP
LQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILFGNDDKMLLVKNIQLEDGK
MILASNFFKGAASSALELTEAELVTAEAVRSAWQRILPNVLEVEDSTDFFKSGAASVDVV
RLVEEVKELCDGLELENEDVYMATTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTL
HMPHQLFIGGAFVDAEGAKTFETINPTDGSVICQVSLAQVTDVDKAVATAKDAFENGRWG
KISARDRGRLLYRAPPSPSTRPDPTAT
Download sequence
Identical sequences A0A2K5WY80 A0A2K6D0B8 F7EHJ1
ENSMMUP00000016401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]