SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016403 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016403
Domain Number 1 Region: 711-1004
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.53e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000209
Further Details:      
 
Domain Number 2 Region: 1008-1294
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.54e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 3 Region: 1-204
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.27e-62
Family Carbonic anhydrase 0.0000217
Further Details:      
 
Domain Number 4 Region: 231-325
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000644
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016403   Gene: ENSMMUG00000012487   Transcript: ENSMMUT00000017517
Sequence length 1329
Comment pep:known chromosome:MMUL_1:2:74093125:74399446:-1 gene:ENSMMUG00000012487 transcript:ENSMMUT00000017517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNTGKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSIDGRRFPVEMQI
FFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPF
VLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHV
KSVEYLRNNFRPQQRLHDRVVSKSAVRDAWNHDVTDFLENPLGTEASKVCSSPPIHMKVQ
PLNQTALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPD
SLYLFRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSG
SSTWTSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPT
RLPTAASASKQAARPVLATTEALASPGPNGDSSPTKDSEGTEEGEKDEKSESEDGEREHE
EDGEKDSEKKEKSGVTHAAEERNQTEPSPTPSSPNRTAEGGHHTIPGHEQDHTAIPTDQT
GGRRDAGPGPDPDAVTSTQVPPTATEEQYAGSDPKRPEMPSKKPVSRGDRFSEDSRFITV
NPAEKNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRR
FREVPSSGERGEKGSRKCFQTAHFYVEDSNSPRVVPNESIPIIPIPDDMEAIPVKQFVKH
IGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPL
PGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEK
GRRKCDQYWPTENSEEYGNIIVTLKSTKVHACYTVRRFSVRNTKVKKGQKGNPKGRQNER
IVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPEMGPVLVHCSAGVGRTGTYIVIDSM
LQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYV
NSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAP
LPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLA
EDEFVYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLKVRHFQC
PKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENA
VDVFQVAKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDKNGAVLIADESD
PAESMESLV
Download sequence
Identical sequences ENSMMUP00000016403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]