SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016404 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016404
Domain Number 1 Region: 827-1120
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.48e-106
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000209
Further Details:      
 
Domain Number 2 Region: 59-319
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.23e-78
Family Carbonic anhydrase 0.0000083
Further Details:      
 
Domain Number 3 Region: 1124-1410
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.98e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 4 Region: 347-441
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000722
Family Fibronectin type III 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016404   Gene: ENSMMUG00000012487   Transcript: ENSMMUT00000017518
Sequence length 1445
Comment pep:known chromosome:MMUL_1:2:74094733:74834130:-1 gene:ENSMMUG00000012487 transcript:ENSMMUT00000017518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLLEPCWWILFLKITSSVLHYVVCFPALTEGYVGALHENRHGSAVQIRRRKASGDPYW
AYSGAYGPEHWVTSSVSCGGHHQSPVDILDQHARVGEEYQELQLDGFDNESSNKTWMKNT
GKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSIDGRRFPVEMQIFFYN
PDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFVLRD
LLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVE
YLRNNFRPQQRLHDRVVSKSAVRDAWNHDVTDFLENPLGTEASKVCSSPPIHMKVQPLNQ
TALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYL
FRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTW
TSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFGGGGISSFPSTVWPTRLPT
AASASKQAARPVLATTEALASPGPNGDSSPTKDSEGTEEGEKDEKSESEDGEREHEEDGE
KDSEKKEKSGVTHAAEERNQTEPSPTPSSPNRTAEGGHHTIPGHEQDHTAIPTDQTGGRR
DAGPGPDPDAVTSTQVPPTATEEQYAGSDPKRPEMPSKKPVSRGDRFSEDSRFITVNPAE
KNTSGMISRPAPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIKSKGFPRRFREV
PSSGERGEKGSRKCFQTAHFYVEDSNSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGEL
YSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAYDHSRVKLRPLPGKD
SKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVMITNLVEKGRRK
CDQYWPTENSEEYGNIIVTLKSTKVHACYTVRRFSVRNTKVKKGQKGNPKGRQNERIVIQ
YHYTQWPDMGVPEYALPVLTFVRRSSAARMPEMGPVLVHCSAGVGRTGTYIVIDSMLQQI
KDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSSNQLHSYVNSIL
IPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGM
KGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEF
VYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVLKVRHFQCPKWP
NPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVF
QVAKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDKNGAVLIADESDPAES
MESLV
Download sequence
Identical sequences ENSMMUP00000016404 9544.ENSMMUP00000016404 ENSMMUP00000039553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]