SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016539 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016539
Domain Number 1 Region: 311-376
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000471
Family IBR domain 0.024
Further Details:      
 
Domain Number 2 Region: 390-444
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000132
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Domain Number 3 Region: 239-282
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000125
Family RING finger domain, C3HC4 0.03
Further Details:      
 
Domain Number 4 Region: 15-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000612
Family Ubiquitin-related 0.011
Further Details:      
 
Domain Number 5 Region: 150-178
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000341
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016539   Gene: ENSMMUG00000012601   Transcript: ENSMMUT00000017662
Sequence length 468
Comment pep:known chromosome:MMUL_1:10:33660110:33681372:1 gene:ENSMMUG00000012601 transcript:ENSMMUT00000017662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAATPDGREDQERLWVSVEDAQMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPVLQQWV
IGQRLARDQETLHSHGVRQNGDSAYLYLLSARNTSLNPQELQRERQLRMLEDLGFKDLTL
QPRGPLEPGPPKPRVPQEPGRGQPDAVPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPE
AYQVPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLDQRSLVLNTEPAEC
PVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVSCPFIDNTYSCSGKLLEREIK
ALLTPEDYQRFLDLGISIAENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFHVNCLLC
KAIHEQMNCKEYQEDLALRAQNDVAARQTTEMLKVMLLQGEAMRCPQCQIVVQKKDGCDW
IRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Download sequence
Identical sequences A0A2K5VYQ0
ENSMMUP00000016539 XP_015004777.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]