SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016541 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016541
Domain Number 1 Region: 39-120
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000235
Family Ubiquitin-related 0.011
Further Details:      
 
Domain Number 2 Region: 182-210
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000000612
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016541   Gene: ENSMMUG00000012601   Transcript: ENSMMUT00000017664
Sequence length 262
Comment pep:known chromosome:MMUL_1:10:33661662:33674277:1 gene:ENSMMUG00000012601 transcript:ENSMMUT00000017664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDIRLWVSVEDAQMHTVT
IWLTVRPDMTVASLKDMVFLDYGFPPVLQQWVIGQRLARDQETLHSHGVRQNGDSAYLYL
LSARNTSLNPQELQRERQLRMLEDLGFKDLTLQPRGPLEPGPPKPRVPQEPGRGQPDAVP
EPPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQVPASYQPDEEERARLAGEEEALRQY
QQGVPAGHHPQQPGGGGLLPLH
Download sequence
Identical sequences ENSMMUP00000016541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]