SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016587 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016587
Domain Number 1 Region: 501-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000474
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 2 Region: 316-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 3 Region: 1361-1401
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000893
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 1222-1270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 5 Region: 1312-1363
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 6 Region: 257-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000314
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 7 Region: 596-646
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family Laminin-type module 0.0037
Further Details:      
 
Domain Number 8 Region: 456-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000949
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 9 Region: 555-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.018
Further Details:      
 
Domain Number 10 Region: 649-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000893
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 11 Region: 384-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000019
Family Laminin-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016587
Domain Number - Region: 62-143
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000712
Family APC10-like 0.038
Further Details:      
 
Domain Number - Region: 1274-1314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0446
Family Laminin-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016587   Gene: ENSMMUG00000031416   Transcript: ENSMMUT00000017712
Sequence length 1402
Comment pep:novel chromosome:MMUL_1:10:2171900:2211761:1 gene:ENSMMUG00000031416 transcript:ENSMMUT00000017712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEAALRGERTVLHPPYFNLAEGARIAASATCGEAEDLYCKLVGGPVAGGDPNQTIQGQYC
DICTAANSNRAHPASNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFAN
SPRPDLWVLERSMDFGRTYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIV
PLENPQIVVSLVNGRPGAMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTV
TRRYYYSIKDISIGGRCVCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQ
PWKPATANSANECQSCNCHGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGV
NCERCLPGFYRSPDHPLDSPHVCCRCNCESNFTDGTCEDLTGRCYCRPNFSGERCDVCAE
GFTGFPSCYREHLPATPSSSNDTREQVLPAGQIVMCGCSPAGTLPEGCDEAGRCPCQPGF
AGPHCDQCHPGYHGFPNCQPCHCSAEGSLHAACDPQSGQCSCRPRVTGLRCDTCVPGAYN
FPYCEGWSSAPTAGDSCEWGGGSCVCRANVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDP
RGTLGGVAECQPGTGQCFCKPHVCGQACAACKDGFFGLDQADYFGCRSCRCDAGGALGQS
CEPRTGACRCRPNTQGPTCSRPVRDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
FSWRGYAQMAPVQTQPRIVARLNLTSPDLFWLIFRYVNRGAVSVSGRVSESHSLPPPGTA
QSQPVAFPPSTEPAFVTVPQRGFGEPFVLNPGTWALLVEAEGVLLDYVVLLPSAYYEAAL
LQLRVTEACTYRPSTQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQLSP
SHPPLVTCTGSDVDVQLQVAVPQPGRYPAVVEYANEDARQEVGVAVHTPQRAPQQGLLSL
HPCLYSTARDTQDRLAVFHLDSEANVRLTAEQAHFYLHGVTLVPMEEFSPEFVEPRVRCI
SSHGAFGPSSAACLPSRFPKPPQPIILRDCQVIPLPPGLPLTQAQDLMPATSPTGPQATV
VFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLINAGRVWQGECLGCGLEGLPHTMRLERCS
PHPSPTFPEKPGSRLCLDYVLVVPENVYSFGYLREEPLDKSYDFISHCAAQGYHISPGSS
SLFCRNAAASLSLFYNNGARPCGCHEVGATGPTCEPFGGQCPCRAHVIGRDCSRCATGYW
GFPNCRPCDCGARLCDELTGQCICPPRTVPPECLLCQPQTFGCHPLVGCEECNCSGPGVQ
ELTDPTCDTDSGQCKCRPNVTGRRCDTCSPGFHGYPHCRPCDCHEAGTAPGVCDPLTGQC
YCKENVQGPRCDQCSLGTFSLD
Download sequence
Identical sequences 9544.ENSMMUP00000016587 ENSMMUP00000016587 ENSMMUP00000038236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]