SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016642 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016642
Domain Number 1 Region: 815-942,986-1160
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.3e-77
Family Protein kinases, catalytic subunit 0.000000000103
Further Details:      
 
Domain Number 2 Region: 665-752
Classification Level Classification E-value
Superfamily Immunoglobulin 7e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 3 Region: 339-452
Classification Level Classification E-value
Superfamily Immunoglobulin 2.95e-18
Family I set domains 0.021
Further Details:      
 
Domain Number 4 Region: 227-330
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000214
Family I set domains 0.043
Further Details:      
 
Domain Number 5 Region: 556-662
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000356
Family V set domains (antibody variable domain-like) 0.038
Further Details:      
 
Domain Number 6 Region: 432-460,493-545
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000319
Family I set domains 0.071
Further Details:      
 
Domain Number 7 Region: 114-218
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000757
Family I set domains 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016642
Domain Number - Region: 32-106
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000136
Family I set domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016642   Gene: ENSMMUG00000012669   Transcript: ENSMMUT00000017770
Sequence length 1356
Comment pep:known chromosome:MMUL_1:5:74271256:74318981:1 gene:ENSMMUG00000012669 transcript:ENSMMUT00000017770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKVLLAVALWLCVETRAASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLD
WLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETDLASVIYVYVQD
YRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWD
SKKGFTIPSYMISYAGMVFCEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGVELSVGE
KLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFLSTLTIDGVTRS
DQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPVKYLGYPPP
EIKWYKNGIPLESNHTVKVGHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVP
PQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECPNEPSQAVSVTNPY
PCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGE
RVISFHVTRGPEITLQPDLQPTEQESVSLWCTADKSTFENLTWYKLGPQPLPVHVGELPT
PVCKNLDTLWKLNATIFSNSTNDILIMELKNASLQDQGDYVCVAQDRKTKKRHCVVRQLT
VLERVAPMITGNLENQTTSIGETIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNR
NLTIRRVRKEDEGLYTCQACSVLGCAKVEAFFIIEGAQEKTNLEIIILVGTAVIAMFFWL
LLVIILRTVKRANGGELKTGYLSIVMDPDELPLDEHCERLPYDASKWEFPRDRLKLGKPL
GRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVN
LLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKTKGARFRQGKDYVGAIPVDLK
RRLDSITSSQSSASSGFVEEKSLSDVEEEEAPEDLYKDFLTLEHLICYSFQVAKGMEFLA
SRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDR
VYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTML
DCWHGEPSQRPTFSELVEHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVS
CMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDS
GMVLASEELKTLEDRTKLAPSFSGMVSSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYS
SEEAELLKLIEIGVQTGSTAQILQPDSGTTLSSPPV
Download sequence
Identical sequences F7E313
ENSMMUP00000016642 ENSMMUP00000016642 XP_014994176.1.72884 9544.ENSMMUP00000016642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]