SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016657 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016657
Domain Number 1 Region: 36-522
Classification Level Classification E-value
Superfamily ALDH-like 5.24e-144
Family ALDH-like 0.000000395
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016657   Gene: ENSMMUG00000012684   Transcript: ENSMMUT00000017785
Sequence length 539
Comment pep:known chromosome:MMUL_1:7:137157754:137181259:-1 gene:ENSMMUG00000012684 transcript:ENSMMUT00000017785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVVAAAAAAVRARILQATVSSKVKSNSAWYSASSFSSSVPAVKLFIDGKFVESKSDKW
IEIHNPATNEVIGRVPQATKAEMDAAIASCKRAFPAWADTSVLSRQQVLLRYQQLIKENL
KEIAKLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMMGETMPSITKDMDLYSYRLPL
GVCAGIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLN
IIHGQHEAVNFICDHPDIKAISFVGSNQAGEYIFERGSRHGKRVQANMGAKNHGVVMPDA
NKENTLNQLVGAAFGAAGQRCMALSTAVLVGEAKKWLPELVERAKNLRVNAGDQPGADLG
PLITPQAKERVCNLIDSGTKEGASILLDGRKIKVKGYENGNFVGPTIISNVKPNMTCYKE
EIFGPVLVVLETETLDEAIQIVNNNPYGNGTAIFTTNGATARKYAHLVDVGQVGVNVPIP
VPLPMFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVAMPTMGR
Download sequence
Identical sequences ENSMMUP00000016657 ENSMMUP00000032734 9544.ENSMMUP00000016657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]