SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016671 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016671
Domain Number 1 Region: 181-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000848
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 57-113
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000133
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 3 Region: 118-179
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000584
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016671   Gene: ENSMMUG00000012695   Transcript: ENSMMUT00000017801
Sequence length 291
Comment pep:known chromosome:MMUL_1:1:146885407:147019928:1 gene:ENSMMUG00000012695 transcript:ENSMMUT00000017801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHGMNPSIGDGFLEQQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQACAD
PGVPENGFRTPSGGVFFEGSVTRFHCQDGFKLKGATKRLCMKYFNGTLGWIPSDKSICVQ
EECRIPQIEDAEIHNKTYRYGEKLIITCHEGFKIRYPDLYNMFSLCRDDGTWNNLPVCQG
CLRPLASTNGYVNISEFQISFPVGTVISYRCFPGFKLDGSAYLECLHNLIWSSSPPRCLA
LEGGRPEHLFPVLYFPHIRLAAAMLYFCPVLKSSPTPAPTCSSTSTTTSLF
Download sequence
Identical sequences A0A2K5VIB5 A0A2K6B700 F7DX72
ENSMMUP00000016671 XP_005540994.1.63531 XP_011733508.1.29376 XP_014971065.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]