SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016681 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016681
Domain Number 1 Region: 10-207
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 2.22e-44
Family Isochorismatase-like hydrolases 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016681   Gene: ENSMMUG00000012704   Transcript: ENSMMUT00000017813
Sequence length 221
Comment pep:known chromosome:MMUL_1:19:61478912:61482989:-1 gene:ENSMMUG00000012704 transcript:ENSMMUT00000017813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAARPILGRVLPGSSILFLCDMQEKFRHNIAYFPQIVSVAARMLRVARLLEVPVLLTEQ
YPQGLGPTVPELGAEGLQPLTKTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILDPCS
YPGLALTSLYPQNTTLDLLDRGLQVHVVVDACSSRSQVDRLVALARMRQSGAFLSTSEGL
ILQLVGDAAHPQFKEIQKLIKEPAPDSGLLGLFQGQNPLLH
Download sequence
Identical sequences A0A2K5UEA6 A0A2K6A1P5
XP_011852356.1.47321 9544.ENSMMUP00000016681 ENSMMUP00000016681 ENSMMUP00000016681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]