SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016798 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016798
Domain Number 1 Region: 27-279
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-72
Family Eukaryotic proteases 0.00000000294
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016798
Domain Number - Region: 2-31
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00199
Family Complement control module/SCR domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016798   Gene: ENSMMUG00000012786   Transcript: ENSMMUT00000017938
Sequence length 280
Comment pep:novel chromosome:MMUL_1:11:7273923:7276087:1 gene:ENSMMUG00000012786 transcript:ENSMMUT00000017938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQYHCASNGSWVNEALSPELPKCVPVCGVPREPFEGKQRIIGGSDADIKNFPWQVFFDNP
WAGGALIDEYWVLTAAHVVEGNQEPTMYVGSTSVQTSRLAKSKMLTSERVFIHPGWKLLE
VPEARTNFDNDIALVQLKDPVKMGPTVAPICLPGTSSDYNLMDGDLGLIAGWGRTEKRDR
ALRLKAARLPVAPLRKLENPKADAGAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPND
KAKFYVAGLVSWGPQCGTYGLYTRVQNYVDWIKKTMQENS
Download sequence
Identical sequences ENSMMUP00000016798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]