SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016836 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016836
Domain Number 1 Region: 4-358,388-408
Classification Level Classification E-value
Superfamily Thiolase-like 2.34e-75
Family Thiolase-related 0.0021
Further Details:      
 
Domain Number 2 Region: 2226-2502
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.79e-64
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000131
Further Details:      
 
Domain Number 3 Region: 1641-1799
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.05e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.0000814
Further Details:      
 
Domain Number 4 Region: 495-620,683-771
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-38
Family FabD-like 0.0057
Further Details:      
 
Domain Number 5 Region: 1886-2081
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.38e-33
Family Tyrosine-dependent oxidoreductases 0.00023
Further Details:      
 
Domain Number 6 Region: 1219-1404
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.83e-17
Family UbiE/COQ5-like 0.031
Further Details:      
 
Domain Number 7 Region: 1560-1676
Classification Level Classification E-value
Superfamily GroES-like 5.76e-16
Family Alcohol dehydrogenase-like, N-terminal domain 0.0073
Further Details:      
 
Domain Number 8 Region: 2125-2189
Classification Level Classification E-value
Superfamily ACP-like 0.0000000000038
Family Acyl-carrier protein (ACP) 0.00019
Further Details:      
 
Domain Number 9 Region: 620-676
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000157
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016836   Gene: ENSMMUG00000012811   Transcript: ENSMMUT00000017977
Sequence length 2512
Comment pep:known_by_projection chromosome:MMUL_1:16:77550167:77567891:-1 gene:ENSMMUG00000012811 transcript:ENSMMUT00000017977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAMEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDRRWKAGLYGLPRRSGKLKDL
SRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDAGINPASLRGTHTGVWVGVSGSEAS
EALSRDPETLVGYSMVGCQRAMMANRLSFFFDFKGPSIALDTACSSSMVALQSAYQAISS
GQCPAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDAEGNGYCRSEGVVAVLLTKKS
LARRVYATILNAGTNTDGCKEQGVTFPSGEAQEQLIRSLYQSAGVAPESFEYIEAHGTGT
KVGDPQELNGIARALCATRQEPLLVGSTKSNMGHPEPVSGLAALAKVLLSLEHGLWAPNL
HFHSPHPEIPALLDGRLQVVAQPLPVRGGNVGINSFGFGGSNVHVILRPHTQPPPAPAPH
ASLPRLLRASGRTPEAVQELLEQGLQHSQELAFLSMLNDIAAIPTTAMPFRGYAVLGGEH
SGPEVQQVPAGERPLWFICSGMGTQWRGMGLSLMRLDRFRDSILRSDEAVKPFGLKVSQL
LLSMDESTFDDIVHAFVSLTAIQIGLIDLLSCMGLRPDGIIGHSLGEVACGYADGCLSQE
EAVLAAYWRGQCIKEAHLPPGAMAAVGLSWEECKQRCPPGVVPACHNSKDTVTISGPQAS
VFEFMEQLRKEGVFAKEVRTGGMAFHSYFMEAIAPPLLQALKKVIREPKPRSARWLSTSI
PEAQWHSSLARTSSAEYNVNNLVSPVLFQEALCHVPEHAVVLEVAPHALLQVGPAWVWQK
GFPVNPMMKDHRDNLEFFLTGIGRLHLSGIDANPNALFPPVEFPAPRGTPLISPLIKWDH
SLAWDVPAAEDFPNGSGSPSAAVYNIDTSSESPDHYLVDHTIDGRVIFPATGYLCIVWKT
LARALGLAVEQLPVVFEDVVLHQATILPKTGTVSLEVRLLEASRAFEVSQNGNLIVSGKV
YQWEDPDPRLFNHPESPTPNPEEPLFLTQAEVYKELRLRGYDYGPHFHGILEASLEGESG
RLLWKDNWVSFLDAMLQISILGLAKRSLHLPTRITAIHIDPATHRQKLYTLQDDAQVADV
VVSRWLSITVAGGVHMSRVHTESAPRRQQDQQVPILEKFCFTPHVEEGCLSERAALQKEL
QLCKGLAQALQTKVTQQGLRMVVPGLDGAQVPQDPLQQGLPQLLSAACRLQLNGNLQLEL
AQVLAQKRPELSEDPLLSGLLDSPALRACLDTAVENMPSRKMKVVEVLAGHGHLYSRIPG
LLGAQPLLQLSYTATDRHPQALEAAEAQLQQHDIAQGQWDPADPAPSTLGSTDLLVCNCA
VAALGDPASALSNMVATLREGGFLLLHTLLRGHPLGETVAFLTSAEPQYGQGILSQDAWE
SLFSSVSLRLVGLKKSFYGSALFLCRRPAPQDSPIFLPVDDTSFRWVESLKGILADEDSS
RPVWLKAVNCATSGVVGLVNCLRQEPGGHRLRCVLLSNLSSTSRVPEVDPGSAELQKVLQ
GDLVMNVYRDGAWGAFRHFLLEEDKPEEPTAHAFVTTLTRGDLSSIRWVCSSLRHAQPSR
PGAQLCTVYYASLNFRDIMLATGKLSPEAIPGKWASQDNLLGMEFSGRDPSGKRVMGLVP
AEGLATSVLLSPDFLWDVPSNWTLEEAASVPVVYCTAYYSLVVRGRVRPGETVLIHSGSG
GVGQAAIAIALSLGCRVFTTVGSSEKRAYLQARFPQLDSTSFANSRDTSFEQHVLRHTGG
KGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSQNHPLGMAIFLKNVTFHGILLDA
LLDGSAEWQEVAALLQAGIRDGVVQPLKCTVFPGAQVEDAFRYMAQGKHIGKVLVQVLAE
EPEAVLKGAKPTLMSAISKTFCPAYKSYIIAGGLGGLGLELAQWLIQRGAQKLVLTSRSG
VRTGYQAKQVRQWRRQGVQVLVSTSNISSLEGARGLIAEAAQLGPVGGIFNLTMVLRDAM
LENQTPEFFQDVCKPKYSGTLNLDRVTREACPELDYFVVFSSVSSGRGNAGQSNYGFANS
AMERICEKRRHEGLPGLAVQWGAIGDVGILADTVNIHATVIGGTLPQRVASCLEVLDLFL
NQPHMVLSSFVLAEKAAAYRDRDGEQDLVKAVAHILGIRDLAAINLDSSLADLGLDSLMS
VEVRQTLERELNLVLSMREVRQLTLRRLQELSLKADAANDLASPTPKEDGPAQQQTQLNL
RSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPL
DSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQNPAPTHNSLFLFDG
SHTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAA
AVDLIIKSHQGLDRQELSFAALSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLG
ADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIVSIIHSSLAEPRVSVREG
Download sequence
Identical sequences ENSMMUP00000016836 9544.ENSMMUP00000016836 ENSMMUP00000016836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]