SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017030 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017030
Domain Number 1 Region: 50-246
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-67
Family Protein kinases, catalytic subunit 0.0000615
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017030   Gene: ENSMMUG00000012972   Transcript: ENSMMUT00000018191
Sequence length 256
Comment pep:known_by_projection chromosome:MMUL_1:7:53649314:53652077:-1 gene:ENSMMUG00000012972 transcript:ENSMMUT00000018191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAAFPAGGAGGSVEQPRARPVPQPAGTAARSEEAPARARAAGMAGPGWGPPRLDGFILTE
RLGSGRYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLLTEIEILKGIRHPHIVQLK
DFQWDSDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERSISHLDL
KPQNILLSSLEKPHLKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCQRQYDARVDLWS
VGVILYGETSFPCFSR
Download sequence
Identical sequences ENSMMUP00000017030 9544.ENSMMUP00000017030 ENSMMUP00000017030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]