SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017053 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017053
Domain Number 1 Region: 1225-1308,1360-1514
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 113-280,329-400
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-32
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 511-744
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-27
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 940-1061,1101-1179
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-26
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017053
Domain Number - Region: 888-940
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000259
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number - Region: 1519-1666
Classification Level Classification E-value
Superfamily EF-hand 0.0242
Family Calmodulin-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017053   Gene: ENSMMUG00000012988   Transcript: ENSMMUT00000018215
Sequence length 2206
Comment pep:known chromosome:MMUL_1:11:2204275:2789343:1 gene:ENSMMUG00000012988 transcript:ENSMMUT00000018215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTV
SSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKYPLPFEIIILLT
IFANCVALAIYIPFPEDDSNATNSNLERSELFFKCIFSRDGFLKVICTGDFFYPFQSKYS
SWNHLDFLICKLELFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPS
LQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDP
SPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVN
DAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEED
LKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARL
AHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLT
EVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMSP
LGISVLRCVRLLRIFKITRYRASPLTLERGLREKLNSVSSMLHLLFSLSHLQSLFKMQLF
GGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYF
IILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMVEK
PAVEESKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNPETTGEEDEEEPEM
PVGPRPRPLSELHLKEKAVPMPEASAFFVFSSNNRFRLQCHRIVNDTIFTNLILFFILLS
SISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNADYVFTSIFTLEIILKMT
AYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAK
GLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNY
ITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKG
PIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYA
LKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNI
LNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNT
FDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFRLFRVMRLVKLLSRGEG
IRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQA
VLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAF
LIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQ
PPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEEL
RAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQ
RNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGN
HVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDSTFTPSSYSSTGSNA
NINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQEVAWKLSSKRESHALVWEGL
ELRRDSGLAGTQAHCPLLRRANPSRRGFLSSQTAMVGPEETSQDETYEVKMNHDAEACSE
PSLLSTDINYQNAPNHSLTRPSMSASVLFSCPDPGSLAGFAGRRASFHLECLKRQKDRGG
DISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPIPTL
RLEGAESSEKLNSSFPSIHCGSWAETTPGGGDSNTTRRARPVSLMVPSQAGAPGRQFHGS
ASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNG
ALLPFVNCRDAGQDRAGGEEDAGCARARGRLSEEELQDSRVYVSSL
Download sequence
Identical sequences ENSMMUP00000017053 ENSMMUP00000017053 9544.ENSMMUP00000017053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]